PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010099896.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
Family NF-YB
Protein Properties Length: 254aa    MW: 28081.9 Da    PI: 6.8447
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010099896.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB179.62.8e-5632127297
           NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelege 96 
                     +eqdr+lPianvsrimkk lP+nakisk+aketvqecvsefisf+t+easdkcqrekrkt+ngddllwa++tlGfe+yv plkvyl+kyre+ege
  XP_010099896.1  32 KEQDRLLPIANVSRIMKKSLPSNAKISKEAKETVQECVSEFISFITGEASDKCQREKRKTVNGDDLLWAMTTLGFENYVGPLKVYLNKYREVEGE 126
                     89********************************************************************************************9 PP

           NF-YB  97 k 97 
                     k
  XP_010099896.1 127 K 127
                     7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.102.7E-5330148IPR009072Histone-fold
SuperFamilySSF471138.09E-4134150IPR009072Histone-fold
PfamPF008084.2E-2737101IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006151.6E-196583No hitNo description
PROSITE patternPS0068506884IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006151.6E-1984102No hitNo description
PRINTSPR006151.6E-19103121No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 254 aa     Download sequence    Send to blast
MSSKGNYQAT SNTSPIGSPL QGNNICDINS SKEQDRLLPI ANVSRIMKKS LPSNAKISKE  60
AKETVQECVS EFISFITGEA SDKCQREKRK TVNGDDLLWA MTTLGFENYV GPLKVYLNKY  120
REVEGEKNFM SRQEDHHSPT TNTTTSSNHG PHHHDHDYHQ MVNINNNNKG SNSVPLINKV  180
DFQDFNSGGF HSLGGQMNVP KSYEEVSNGM VFGYGSDNYV SGISNYNVNV THESGGDGNA  240
NRVMAAHLHH GIGW
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B1e-4832122292Transcription factor HapC (Eurofung)
4g92_B1e-4832122292Transcription factor HapC (Eurofung)
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010099896.10.0Nuclear transcription factor Y subunit B-3
TrEMBLW9RLN50.0W9RLN5_9R
STRINGGLYMA05G31681.11e-80(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF59134150
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14540.14e-63nuclear factor Y, subunit B3